View larger

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_493323 (ARALYDRAFT_493323)

CSB-CF518695DNZ

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_493323 (ARALYDRAFT_493323)

See below for Detailed Description

More details

CAD$1,536.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Uniprot NO.:D7MAF6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENEGKNNMNGMEMEKGKRESRSRKGVELTMRVLALVLTMAAATVLGVAKQTKVVSIKLI PALPPLDITTTAKASYLSAFVYNISANAIACGYTAISIAILMISRGRRSKKLLMAVLLGD LVMVALLFSGTGAASAIGLMGLQGNKHVMWNKVCGVFGKFCHRAAPSLPLTFLAAVVFMF LVVLDAIKLP

Protein Names:Recommended name: CASP-like protein ARALYDRAFT_493323

Gene Names:ORF Names:ARALYDRAFT_493323

Expression Region:1-190

Sequence Info:full length protein

30 other products in the same category: