View larger

Recombinant Human Tumor protein p53-inducible protein 11(TP53I11)

CSB-CF024082HU

Recombinant Human Tumor protein p53-inducible protein 11(TP53I11)

See below for Detailed Description

More details

CAD$1,534.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14683

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPL GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFGVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYY QVGRRPKKA

Protein Names:Recommended name: Tumor protein p53-inducible protein 11 Alternative name(s): p53-induced gene 11 protein

Gene Names:Name:TP53I11 Synonyms:PIG11

Expression Region:1-189

Sequence Info:full length protein

30 other products in the same category: