View larger

Recombinant Arabidopsis thaliana PRA1 family protein F2(PRA1F2)

CSB-CF871685DOA

Recombinant Arabidopsis thaliana PRA1 family protein F2(PRA1F2)

See below for Detailed Description

More details

CAD$1,534.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9C889

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNYGAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISR IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID DRTVLIGLSVLTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAAVTEA SGLMSYPSS

Protein Names:Recommended name: PRA1 family protein F2 Short name= AtPRA1.F2

Gene Names:Name:PRA1F2 Ordered Locus Names:At1g55190 ORF Names:F7A10.20

Expression Region:1-189

Sequence Info:full length protein

30 other products in the same category: