View larger

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Accessory gene regulator protein B(agrB)

CSB-CF675536SBAG

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Accessory gene regulator protein B(agrB)

See below for Detailed Description

More details

CAD$1,534.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Uniprot NO.:Q49YZ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKFIDAKIDNFAKQLQQRNNLDRIEYLKMRLGMQVVVNNFFKTIVIYGVSLLCHMFLYT LTVHLTFFFIRHFAHGAHAKNSLLCYIQSVIYFVLLPWIVGYVQVSSLIMYTLALVGLII ISIYAPSATKKQPIPERLRRGKKIKAICLTLIFLLISLFLNEPYQQLMLLGIVIISILQF PIFFPKEDY

Protein Names:Recommended name: Accessory gene regulator protein B EC= 3.4.-.-

Gene Names:Name:agrB Ordered Locus Names:SSP0842

Expression Region:1-189

Sequence Info:full length protein

30 other products in the same category: