View larger

Recombinant Staphylococcus aureus Riboflavin transporter RibU(ribU)

CSB-CF517200FLH

Recombinant Staphylococcus aureus Riboflavin transporter RibU(ribU)

See below for Detailed Description

More details

CAD$1,534.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain TCH60)

Uniprot NO.:E5QVT2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNGRRKLNMQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGP VAGIIVALVKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIAT IVMTIVLSILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYR RLANFLKRI

Protein Names:Recommended name: Riboflavin transporter RibU Alternative name(s): Riboflavin ECF transporter S component RibU

Gene Names:Name:ribU Ordered Locus Names:HMPREF0772_11721

Expression Region:1-189

Sequence Info:full length protein

30 other products in the same category: