View larger

Recombinant Vitis vinifera CASP-like protein VIT_14s0068g01400 (VIT_14s0068g01400)

CSB-CF419249VFQ

Recombinant Vitis vinifera CASP-like protein VIT_14s0068g01400 (VIT_14s0068g01400)

See below for Detailed Description

More details

CAD$1,534.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7PA04

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESLEVANGKSSALGVSREASSPPQMGFFIAQVVLRFFTLAFTGAAIAVMVTAKETVEVF SISFTVRYSYLSAFKFLVGADAVVCGFSMLSLIFVSIFNKGKSNHYFFLYFHDLILMVLS MSACAAATAVGYVGRYGQDKAAWMAVCGNVKMFCDKALASILLSLIGFICLFLLTIMAAR NLRVSGHLI

Protein Names:Recommended name: CASP-like protein VIT_14s0068g01400

Gene Names:Ordered Locus Names:VIT_14s0068g01400 ORF Names:GSVIVT00037922001, GSVIVT01033020001, VIT_00033020001, VITISV_043317, Vv14s0068g01400

Expression Region:1-189

Sequence Info:full length protein

30 other products in the same category: