View larger

Recombinant Arabidopsis thaliana PRA1 family protein F4(PRA1F4)

CSB-CF862792DOA

Recombinant Arabidopsis thaliana PRA1 family protein F4(PRA1F4)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LIC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANNDEITTSSHASPAVNHESISRAKQRIKDGLATRRSWRVMFDLHSTGLPHGVSDVFSR IKTNLAYFRSNYAIVILNVIFFSLIWHPTSLIVFTGLVFLWIFLYFLRDVPLKVFRFQID DRAVLIGLSVITIVLLLLTNATFNIVAALMAGAVLVLIHAVIRKTDDLFLDEEAATTETS GLTSHPSS

Protein Names:Recommended name: PRA1 family protein F4 Short name= AtPRA1.F4

Gene Names:Name:PRA1F4 Ordered Locus Names:At3g13710 ORF Names:MMM17.13

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: