View larger

Recombinant Caulobacter crescentus Probable intracellular septation protein A(CC_3678)

CSB-CF857603DQO

Recombinant Caulobacter crescentus Probable intracellular septation protein A(CC_3678)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caulobacter crescentus (strain ATCC 19089 / CB15)

Uniprot NO.:Q9A288

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRTVVDYGAAIAFGVAYFVTKDFQKATWVLVAASAAALAIGYAVERRLAMLPLFFGGMAL VFGTLGLIFGSDVFVKIKVTVINLALASFLVGGVLLKRQPLKVIMGEALHLPDAAWRTLT LRYGAYFAFVAIINEVVRNTQDTDTWVKFRLALLPVALVFVATQLPFMMKHMAKGDDAKA VEPPDAGF

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:CC_3678

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: