View larger

Recombinant Erwinia carotovora subsp. atroseptica Probable intracellular septation protein A(ECA2313)

CSB-CF732148EAAB

Recombinant Erwinia carotovora subsp. atroseptica Probable intracellular septation protein A(ECA2313)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)

Uniprot NO.:Q6D4S7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLDFIPLVVFFAAYKLYDIYIASGALIAATALSLVVTWVMYRKIEKMTLVTFAMVVI FGSLTLVFHNDLFIKWKVTIIYGLFAVALLVSQFVMKQTLIQKMLGKELTLPQPVWGKLN FAWAMFFLVCGLVNIYIAFWLPQSVWVNFKVFGLTGVTLLFTLICGVYIYRHLPNDQEKS EEEKSEQP

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:ECA2313

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: