View larger

Recombinant Shigella dysenteriae serotype 1 UPF0059 membrane protein yebN(yebN)

CSB-CF658299SGF

Recombinant Shigella dysenteriae serotype 1 UPF0059 membrane protein yebN(yebN)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella dysenteriae serotype 1 (strain Sd197)

Uniprot NO.:Q32F38

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG

Protein Names:Recommended name: UPF0059 membrane protein yebN

Gene Names:Name:yebN Ordered Locus Names:SDY_1967

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: