View larger

Recombinant Xenopus laevis Transmembrane protein 205(tmem205)

CSB-CF023799XBE

Recombinant Xenopus laevis Transmembrane protein 205(tmem205)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GPW4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVAEGDPGNLVKIFHLLVLSASWGMQCWMTFVAGFVLIKGVPRHTFGLVQSKLFPYYNHI VLCCSFISLAIYAAYHPRELLSPSESVQISLFFTSLLVAALQARWFSPVTTKTMFKMHVI EREHSLGQGVGLSANKEGYQLLQEKDPKYKALRKRFMRYHGISSLCNLLCLLCNGANLVY IALLMPTL

Protein Names:Recommended name: Transmembrane protein 205

Gene Names:Name:tmem205

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: