View larger

Recombinant Pectobacterium carotovorum subsp. carotovorum Probable intracellular septation protein A (PC1_1997)

CSB-CF513760ESQ

Recombinant Pectobacterium carotovorum subsp. carotovorum Probable intracellular septation protein A (PC1_1997)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Uniprot NO.:C6DGY9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLDFIPLVVFFAAYKLYDIYIASGALIAATALSLAVTWMMYRKIEKMTLVTFAMVVV FGSLTLVFHNDLFIKWKVTIIYALFAVALLVSQFVMKQTLIQKMLGKELTLPQSVWGKLN FAWAMFFLVCGLVNIYIAFWLPQSVWVNFKVFGLTGVTLLFTLICGVYIYRHLPGDQEKP EEEKSEQP

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:PC1_1997

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: