View larger

Recombinant Escherichia coli O139:H28 UPF0059 membrane protein yebN(yebN)

CSB-CF422993EJD

Recombinant Escherichia coli O139:H28 UPF0059 membrane protein yebN(yebN)

See below for Detailed Description

More details

CAD$1,533.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O139:H28 (strain E24377A / ETEC)

Uniprot NO.:A7ZMU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG

Protein Names:Recommended name: UPF0059 membrane protein yebN

Gene Names:Name:yebN Ordered Locus Names:EcE24377A_2050

Expression Region:1-188

Sequence Info:full length protein

30 other products in the same category: