View larger

Recombinant Vibrio vulnificus Probable intracellular septation protein A(VV1213)

CSB-CF762700VCQ

Recombinant Vibrio vulnificus Probable intracellular septation protein A(VV1213)

See below for Detailed Description

More details

CAD$1,532.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vibrio vulnificus (strain YJ016)

Uniprot NO.:Q7MM60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQILDFIPLIIFFALYKMYDIYVATGALIAATAIQIVVTYALYKKVEKMQLITFLMVAI FGGMTIFLHDDNFIKWKVTIVYAVFAIGLTVSHVMGKSAIKGMLGKEITLPESVWANINW AWVGFFTFCAGLNIYVAYQLPLDVWVNFKVFGLLAATLVFTVLTGGYIYKHLPKEQNGQS SDVPTDE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:VV1213

Expression Region:1-187

Sequence Info:full length protein

30 other products in the same category: