View larger

Recombinant Mouse Transmembrane protein 212(Tmem212)

CSB-CF023806MO

Recombinant Mouse Transmembrane protein 212(Tmem212)

See below for Detailed Description

More details

CAD$1,532.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8C6V3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKGLYQAAGRTLVTLGGLSIFSGAIAFFPVFSCKLWYTGWSVWIACPIWNGALAVTAGSL VLLAHREWTQRHLWEAVFTFVILSILGCPLHFTVALQSALLGPYCFYSFSGVAGTNYLGY VVTFPFPYTKFPSVCVDPLHYEEYHLTLQVLDLCLSLILFCVSLAVFIKLSARLMQTGYI NGPENPQ

Protein Names:Recommended name: Transmembrane protein 212

Gene Names:Name:Tmem212

Expression Region:1-187

Sequence Info:full length protein

30 other products in the same category: