View larger

Recombinant Glycine max CASP-like protein 5

CSB-CF510495GGV

Recombinant Glycine max CASP-like protein 5

See below for Detailed Description

More details

CAD$1,532.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Glycine max (Soybean) (Glycine hispida)

Uniprot NO.:C6SZP8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGVESKEREVMVAKPVAVGVSDLLLRLLAFTVTLVAAIVIAVDKQTKVVPIQLSDSLPP LDVPLTAKWHQMSAIVYFLVTNAIACTYAVLSLLLALVNRGKSKGLWTLIAVLDAFMVAL LFSGNGAAAAVGVLGYKGNSHVNWNKVCNVFGKFCDQMAASIGVSLIGSLAFLLLVIIPG VRLHRRN

Protein Names:Recommended name: CASP-like protein 5

Gene Names:

Expression Region:1-187

Sequence Info:full length protein

30 other products in the same category: