View larger

Recombinant Staphylococcus aureus Accessory gene regulator protein B(agrB)

CSB-CF352231SKY

Recombinant Staphylococcus aureus Accessory gene regulator protein B(agrB)

See below for Detailed Description

More details

CAD$1,532.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain N315)

Uniprot NO.:P61637

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP IFFPKED

Protein Names:Recommended name: Accessory gene regulator protein B EC= 3.4.-.-

Gene Names:Name:agrB Ordered Locus Names:SA1842

Expression Region:1-187

Sequence Info:full length protein

30 other products in the same category: