View larger

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0073 (BB_0073)

CSB-CF525100BUD

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0073 (BB_0073)

See below for Detailed Description

More details

CAD$1,531.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Uniprot NO.:O51100

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNNLIACLIINNLTLIHFVGFEDIKIKNNIMLIKRYAIITITSLLIYSISFYLYKLFAK NNLLFLVPIFYVILIYVLILLFKVLNDLFIVYNKKSNYSNDFMLSNSSLIAITFFALDKN NGFFEGLEILILSALGILIALMSITSIKKNFDKNPKINILENEPIYFFIIFILSLIPNII ILIYNQ

Protein Names:Recommended name: Uncharacterized protein BB_0073

Gene Names:Ordered Locus Names:BB_0073

Expression Region:1-186

Sequence Info:full length protein

30 other products in the same category: