View larger

Recombinant Lactobacillus gasseri UPF0397 protein LGAS_1499 (LGAS_1499)

CSB-CF311972LAU

Recombinant Lactobacillus gasseri UPF0397 protein LGAS_1499 (LGAS_1499)

See below for Detailed Description

More details

CAD$1,530.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus gasseri (strain ATCC 33323 / DSM 20243)

Uniprot NO.:Q041L7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKQKGLSVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGF SVGFIGHALGDFLMYGQTWWSWVLATAVLGLIIGLYGMRLDLDNGVFTVKQMVGFNVVQI IANVISWLLIAPVGDILIYSEPQNKVFLQGATATITNSLSILILGTILLKAYAATKVKKG SLRKD

Protein Names:Recommended name: UPF0397 protein LGAS_1499

Gene Names:Ordered Locus Names:LGAS_1499

Expression Region:1-185

Sequence Info:full length protein

30 other products in the same category: