View larger

Recombinant Mouse Translocon-associated protein subunit gamma(Ssr3)

CSB-CF866754MO

Recombinant Mouse Translocon-associated protein subunit gamma(Ssr3)

See below for Detailed Description

More details

CAD$1,530.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9DCF9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK

Protein Names:Recommended name: Translocon-associated protein subunit gamma Short name= TRAP-gamma Alternative name(s): Signal sequence receptor subunit gamma Short name= SSR-gamma

Gene Names:Name:Ssr3

Expression Region:1-185

Sequence Info:full length protein

30 other products in the same category: