View larger

Recombinant Clostridium perfringens UPF0397 protein CPF_1836(CPF_1836)

CSB-CF608487CAAN

Recombinant Clostridium perfringens UPF0397 protein CPF_1836(CPF_1836)

See below for Detailed Description

More details

CAD$1,530.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)

Uniprot NO.:Q0TQ20

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKNKLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFL IGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGARFIKINQGVFKLKQIFMFNLIQII ANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGS LRKEY

Protein Names:Recommended name: UPF0397 protein CPF_1836

Gene Names:Ordered Locus Names:CPF_1836

Expression Region:1-185

Sequence Info:full length protein

30 other products in the same category: