Recombinant Bovine Selenoprotein P(SEPP1)

Recombinant Bovine Selenoprotein P(SEPP1)

CSB-EP021018BO
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P49907

Gene Names: SEPP1

Organism: Bos taurus (Bovine)

AA Sequence: ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN

Expression Region: 20-402aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 70.1 kDa

Alternative Name(s): Selenoprotein P-like protein

Relevance: Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Reference: Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression.Saijoh K., Saito N., Lee M.J., Fujii M., Kobayashi T., Sumino K.Brain Res. Mol. Brain Res. 30:301-311(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share