Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Developmental Biology
Uniprot ID: P20339
Gene Names: RAB5A
Organism: Homo sapiens (Human)
AA Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Expression Region: 1-215aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 39.7 kDa
Alternative Name(s):
Relevance: The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB5A is required for the fusion of plasma mbranes and early endosomes. Contributes to the regulation of filopodia extension.
Reference: Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.Kirsten M.L., Baron R.A., Seabra M.C., Ces O.Mol. Membr. Biol. 30:303-314(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.