Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P36373
Gene Names: Klk7
Organism: Rattus norvegicus (Rat)
AA Sequence: VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP
Expression Region: 25-261aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 30.3 kDa
Alternative Name(s): Esterase BKallikrein-related protein K1;Proteinase ARSKG-7Tissue kallikrein
Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
Reference: The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.