CSB-EP009521HU
See below for Detailed Description
This product is no longer in stock
Availability date:
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: P35754
Gene Names: GLRX
Organism: Homo sapiens (Human)
AA Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Expression Region: 1-106aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 38.8 kDa
Alternative Name(s): Thioltransferase-1 ;TTase-1
Relevance: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Reference: Cloning and sequencing of the cDNA encoding human glutaredoxin.Fernando M.R., Sumimoto H., Nanri H., Kawabata S., Iwanaga S., Minakami S., Fukumaki Y., Takeshige K.Biochim. Biophys. Acta 1218:229-231(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.