Recombinant Human Forkhead box protein P1(FOXP1),partial

Recombinant Human Forkhead box protein P1(FOXP1),partial

CSB-EP008841HU
Regular price
$709.00 CAD
Sale price
$709.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transcription

Uniprot ID: Q9H334

Gene Names: FOXP1

Organism: Homo sapiens (Human)

AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ

Expression Region: 1-114aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.2 kDa

Alternative Name(s): Mac-1-regulated forkhead1

Relevance: Transcriptional repressor . Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential . Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in bryonic st cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintainance of hair follicle st cell quiescence; the function probably involves regulation of FGF18 . Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis . Binds to CSF1R promoter elents and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes ses to involve NCOR2 as corepressor . Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization ses to implicate suppression of SA5B . Can negatively regulate androgen receptor signaling .

Reference: The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p.Banham A.H., Beasley N., Campo E., Fernandez P.L., Fidler C., Gatter K., Jones M., Mason D.Y., Prime J.E., Trougouboff P., Wood K., Cordell J.L.Cancer Res. 61:8820-8829(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share