View larger

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3(FKBP3)

CSB-EP008699HU

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3(FKBP3)

See below for Detailed Description

More details

CAD$709.00

More info

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q00688

Gene Names: FKBP3

Organism: Homo sapiens (Human)

AA Sequence: AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Expression Region: 2-224aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41 kDa

Alternative Name(s): 25KDA FK506-binding protein ;25KDA FKBP ;FKBP-25FK506-binding protein 3 ;FKBP-3Immunophilin FKBP25Rapamycin-selective 25KDA immunophilinRotamase

Relevance: FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins.

Reference: Isolation of a human cDNA encoding a 25KDA FK-506 and rapamycin binding protein.Wiederrecht G., Martin M., Sigal N., Siekierka J.J.Biochem. Biophys. Res. Commun. 185:298-303(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

30 other products in the same category: