View larger

Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial

CSB-EP005386TOTa2

Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial

See below for Detailed Description

More details

CAD$1,066.00

More info

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P02710

Gene Names: CHRNA1

Organism: Tetronarce californica (Pacific electric ray) (Torpedo californica)

AA Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Expression Region: 25-234aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 40.8 kDa

Alternative Name(s):

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reference: "Identifying the lipid-protein interface of the Torpedo nicotinic acetylcholine receptor: secondary structure implications." Blanton M.P., Cohen J.B.Biochemistry 33:2859-2872(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

30 other products in the same category: