Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P31783
Gene Names: CD8A
Organism: Bos taurus (Bovine)
AA Sequence: LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Expression Region: 26-189aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 33.9 kDa
Alternative Name(s): CD8a
Relevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Reference: Molecular cloning, reconstruction and expression of the gene encoding the alpha-chain of the bovine CD8 -- definition of three peptide regions conserved across species.Lalor P., Bucci C., Fornaro M., Rattazzi M.C., Nakauchi H., Herzenberg L.A., Alberti S.Immunology 76:95-102(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.