CSB-EP004939MO
See below for Detailed Description
This product is no longer in stock
Availability date:
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O88174
Gene Names: Cd46
Organism: Mus musculus (Mouse)
AA Sequence: CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW
Expression Region: 45-329aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 35.9 kDa
Alternative Name(s): CD46
Relevance: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
Reference: Disruption of mouse CD46 causes an accelerated spontaneous acrosome reaction in sperm.Inoue N., Ikawa M., Nakanishi T., Matsumoto M., Nomura M., Seya T., Okabe M.Mol. Cell. Biol. 23:2614-2622(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.