CSB-EP2355DIL1
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: tnfb
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Danio rerio (Zebrafish) (Brachydanio rerio)
Delivery time: 3-7 business days
Uniprot ID: Q4W898
AA Sequence: AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL
Tag info: N-terminal 6xHis-tagged
Expression Region: 101-242aa
Protein length: Partial
MW: 19.8 kDa
Alternative Name(s): tnf TNF alpha
Relevance:
Reference: "Mmp23b promotes liver development and hepatocyte proliferation through the tumor necrosis factor pathway in zebrafish." Qi F., Song J., Yang H., Gao W., Liu N.A., Zhang B., Lin S. Hepatology 52:2158-2166(2010)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.