>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Immunology
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Phleum pratense (Common timothy)
Delivery time: 3-7 business days
Uniprot ID: Q40962
AA Sequence: ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-286aa
Protein length: Full Length
MW: 48.5 kDa
Alternative Name(s):
Relevance: Allergen Phl p Va Allergen: Phl p 5a
Reference: "Major allergen Phl p Va (timothy grass) bears at least two different IgE-reactive epitopes." Bufe A., Becker W.M., Schramm G., Petersen A., Mamat U., Schlaak M. J. Allergy Clin. Immunol. 94:173-181(1994)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.