View larger

Recombinant Macaca mulatta Growth hormone receptor(GHR),partial

CSB-EP009411MOW

Recombinant Macaca mulatta Growth hormone receptor(GHR),partial

See Below for Detailed Description

More details

CAD$907.00

More info

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cell Biology

Target / Protein: GHR

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Macaca mulatta (Rhesus macaque)

Delivery time: 3-7 business days

Uniprot ID: P79194

AA Sequence: FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

Tag info: C-terminal 6xHis-tagged

Expression Region: 19-264aa

Protein length: Partial

MW: 30.2 kDa

Alternative Name(s): Somatotropin receptor

Relevance: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.

Reference: "Monkey growth hormone (GH) receptor gene expression. Evidence for two mechanisms for the generation of the GH binding protein." Martini J.-F., Pezet A., Guezennec C.Y., Edery M., Postel-Vinay M.-C., Kelly P.A. J. Biol. Chem. 272:18951-18958(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

30 other products in the same category: