View larger

Recombinant Macaca mulatta Interleukin-10(IL10)

CSB-MP011580MOW

Recombinant Macaca mulatta Interleukin-10(IL10)

See Below for Detailed Description

More details

CAD$586.00

More info

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171228

Research areas: Immunology

Target / Protein: IL10

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Macaca mulatta (Rhesus macaque)

Delivery time: 3-7 business days

Uniprot ID: P51496

AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Tag info: C-terminal 10xHis-tagged

Expression Region: 19-178aa

Protein length: Full Length of Mature Protein

MW: 20.7 kDa

Alternative Name(s): Cytokine synthesis inhibitory factor

Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Reference: "Comparative sequence analysis of cytokine genes from human and nonhuman primates." Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A. J. Immunol. 155:3946-3954(1995)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

30 other products in the same category: