CSB-CF009686HU
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: GP1BB
Biologically active: Not Tested
Expression system: in vitro E.coli expression system
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P13224
AA Sequence: CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 26-206aa
Protein length: Full Length of Mature Protein
MW: 39.3 kDa
Alternative Name(s): Antigen CD42b-beta CD_antigen: CD42c
Relevance: Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.
Reference: "The alpha and beta chains of human platelet glycoprotein Ib are both transmembrane proteins containing a leucine-rich amino acid sequence." Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Davie E.W., Roth G.J. Proc. Natl. Acad. Sci. U.S.A. 85:2135-2139(1988)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.