CSB-EP345923ESB
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: LTP2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Parietaria judaica (Pellitory-of-the-wall)(Parietaria diffusa)
Delivery time: 3-7 business days
Uniprot ID: P55958
AA Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 32-133aa
Protein length: Full Length
MW: 27.3 kDa
Alternative Name(s): Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101
Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Reference: "Assignment of disulphide bridges in Par j 2.0101, a major allergen of Parietaria judaica pollen." Amoresano A., Pucci P., Duro G., Colombo P., Costa M.A., Izzo V., Lamba D., Geraci D. Biol. Chem. 384:1165-1172(2003)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.