>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: msyB
Biologically active: Not Tested
Expression system: Baculovirus
Species of origin: Escherichia coli (strain K12)
Delivery time: 3-7 business days
Uniprot ID: P25738
AA Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Tag info: C-terminal 6xHis-tagged
Expression Region: 1-124aa
Protein length: Full Length
MW: 16.3 kDa
Alternative Name(s):
Relevance: Could participate in the normal pathway of protein export.
Reference: "Multicopy suppression: an approach to understanding intracellular functioning of the protein export system." Ueguchi C., Ito K. J. Bacteriol. 174:1454-1461(1992)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.