View larger

Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10),partial

CSB-YP021710MO

Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10),partial

See Below for Detailed Description

More details

CAD$765.00

More info

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: Slc7a10

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P63115

AA Sequence: WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ

Tag info: N-terminal 6xHis-sumostar-tagged

Expression Region: 475-530aa

Protein length: Partial

MW: 22.5 kDa

Alternative Name(s): D-serine transporter Solute carrier family 7 member 10

Relevance: Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.

Reference: "Identification and characterization of a Na+-independent neutral amino acid transporter that associates with the 4F2 heavy chain and exhibits substrate selectivity for small neutral D- and L- amino acids." Fukasawa Y., Segawa H., Kim J.Y., Chairoungdua A., Kim D.K., Matsuo H., Cha S.H., Endou H., Kanai Y. J. Biol. Chem. 275:9690-9698(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

30 other products in the same category: