CSB-EP304437HYEb8
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: hfb2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Hypocrea jecorina (Trichoderma reesei)
Delivery time: 3-7 business days
Uniprot ID: P79073
AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Tag info: N-terminal 10xHis-B2M-JD-tagged
Expression Region: 16-86aa
Protein length: Full Length of Mature Protein
MW: 12.7 kDa
Alternative Name(s): Hydrophobin II
Relevance: Responsible for spore hydrophobicity and protection.
Reference: "Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423(1997)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.