CSB-YP338792YAS
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: caf1
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Yersinia pestis
Delivery time: 3-7 business days
Uniprot ID: P26948
AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 22-170aa
Protein length: Full Length of Mature Protein
MW: 17.6 kDa
Alternative Name(s):
Relevance:
Reference: "Resolving the energy paradox of chaperone/usher-mediated fibre assembly." Zavialov A.V., Tischenko V.M., Fooks L.J., Brandsdal B.O., Aqvist J., Zav'yalov V.P., Macintyre S., Knight S.D. Biochem. J. 389:685-694(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.