CSB-YP336491SVG
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: DOG1
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Delivery time: 3-7 business days
Uniprot ID: P38774
AA Sequence: MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-246aa
Protein length: Full Length
MW: 29.1 kDa
Alternative Name(s):
Relevance: Active on 2-DOG-6P, also very active on fructose-1P.
Reference: "Molecular characterization of a gene that confers 2-deoxyglucose resistance in yeast."Sanz P., Randez-Gil F., Prieto J.A.Yeast 10:1195-1202(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.