>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Signal Transduction
Target / Protein: ATP6AP2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: O75787
AA Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Tag info: N-terminal 6xHis-tagged
Expression Region: 17-350aa
Protein length: Full Length of Mature Protein
MW: 41.5 kDa
Alternative Name(s): ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 ER-localized type I transmembrane adaptor Embryonic liver differentiation factor 10 N14F Renin/prorenin receptor Vacuolar ATP synthase membrane sector-associated protein M8-9
Relevance: Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
Reference: "Pivotal role of the renin/prorenin receptor in angiotensin II production and cellular responses to renin." Nguyen G., Delarue F., Burckle C., Bouzhir L., Giller T., Sraer J.-D. J. Clin. Invest. 109:1417-1427(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.