CSB-EP846028MO
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Epigenetics and Nuclear Signaling
Target / Protein: Scgb3a2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q920H1
AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Tag info: N-terminal 6xHis-GST-tagged
Expression Region: 22-139aa
Protein length: Full Length of Mature Protein
MW: 43.2 kDa
Alternative Name(s): Pneumo secretory protein 1
Relevance: Enzyme and pathway databases
Reference: "UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor."Niimi T., Keck-Waggoner C.L., Popescu N.C., Zhou Y., Levitt R.C., Kimura S.Mol. Endocrinol. 15:2021-2036(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.