CSB-EP015636ENV
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: acpP
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Escherichia coli (strain K12)
Delivery time: 3-7 business days
Uniprot ID: P0A6A8
AA Sequence: MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-78aa
Protein length: Full Length
MW: 24.6 kDa
Alternative Name(s): Cytosolic-activating factor
Relevance: Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Reference: "Altered molecular form of acyl carrier protein associated with beta-ketoacyl-acyl carrier protein synthase II (fabF) mutants." Jackowski S., Rock C.O. J. Bacteriol. 169:1469-1473(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.