CSB-MP005271RA
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: Cfd
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Rattus norvegicus (Rat)
Delivery time: 3-7 business days
Uniprot ID: P32038
AA Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 26-263aa
Protein length: Full Length of Mature Protein
MW: 29.8 kDa
Alternative Name(s): Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D
Relevance: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Reference: "Purification and partial characterization of rat factor D."Baker B.C., Campbell C.J., Grinham C.J., Turcatti G.Biochem. J. 279:775-779(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.