CSB-EP517517SWI
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Salmo salar (Atlantic salmon)
Delivery time: 3-7 business days
Uniprot ID: O13018
AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Tag info: N-terminal 6xHis-B2M-tagged
Expression Region: 1-75aa
Protein length: Partial
MW: 22.5 kDa
Alternative Name(s):
Relevance:
Reference: "A novel and ancient vertebrate opsin." Soni B.G., Foster R.G. FEBS Lett. 406:279-283(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.