Recombinant Hafnia alvei Intimin(eaeA)

Recombinant Hafnia alvei Intimin(eaeA)

CSB-EP346794HAQ
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: eaeA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Hafnia alvei

Delivery time: 3-7 business days

Uniprot ID: P52869

AA Sequence: ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-280aa

Protein length: Full Length

MW: 46.1 kDa

Alternative Name(s): Attaching and effacing protein Outer membrane protein

Relevance: Necessary for the production of attaching and effacing lesions on tissue culture cells.

Reference: "Characterization of the C-terminal domains of intimin-like proteins of enteropathogenic and enterohemorrhagic Escherichia coli, Citrobacter freundii, and Hafnia alvei."Frankel G., Candy D.C.A., Everest P., Dougan G.Infect. Immun. 62:1835-1842(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share