CSB-EP315528DSB
See Below for Detailed Description
This product is no longer in stock
Availability date:
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein: omcB
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Chlamydia trachomatis (strain D/UW-3/Cx)
Delivery time: 3-7 business days
Uniprot ID: P0CC04
AA Sequence: LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 41-196aa
Protein length: Partial
MW: 33.1 kDa
Alternative Name(s): Large-CRP Alternative name(s): 60 kDa cysteine-rich OMP 60 kDa outer membrane protein Cysteine-rich outer membrane protein Short name: CRP
Relevance: In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan.
Reference: "Genome sequence of an obligate intracellular pathogen of humans: Chlamydia trachomatis."Stephens R.S., Kalman S., Lammel C.J., Fan J., Marathe R., Aravind L., Mitchell W.P., Olinger L., Tatusov R.L., Zhao Q., Koonin E.V., Davis R.W.Science 282:754-759(1998).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.