Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bordetella parapertussis
Uniprot NO.:Q7W2U5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIGAS AEIARYLLT
Protein Names:Recommended name: Type IV secretion system protein ptlA homolog
Gene Names:Name:ptlA Ordered Locus Names:BPP4309
Expression Region:34-102
Sequence Info:full length protein