Recombinant Streptomyces avidinii Streptavidin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Streptomyces avidinii Streptavidin

CSB-YP332849SNO
Regular price
$1,263.14 CAD
Sale price
$1,263.14 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P22629

Gene Names: N/A

Organism: Streptomyces avidinii

AA Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Expression Region: 25-183aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 18.5 kDa

Alternative Name(s):

Relevance: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).

Reference: Structural studies of the streptavidin binding loop.Freitag S., le Trong I., Klumb L., Stayton P.S., Stenkamp R.E.Protein Sci. 6:1157-1166(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share